PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19299.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 463aa    MW: 53538.5 Da    PI: 6.2822
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19299.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-17186232148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
       KHN19299.1 186 KGQWTIEEDGLLIQLVEQYGLRKWSHIAKILP-GRIGKQCRERWHNHL 232
                      799*****************************.*************97 PP

2Myb_DNA-binding56.56.3e-18238280145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT eEd+ l++a+++ G++ W+ Ia++++ gRt++++k++w+
       KHN19299.1 238 KDTWTDEEDKVLIEAHAEVGNK-WAEIAKKLP-GRTENSIKNHWN 280
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.227181236IPR017930Myb domain
SuperFamilySSF466891.31E-31183279IPR009057Homeodomain-like
SMARTSM007171.9E-14185234IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-27187238IPR009057Homeodomain-like
PfamPF139217.3E-17189243No hitNo description
CDDcd001671.65E-14189232No hitNo description
SMARTSM007172.9E-17237285IPR001005SANT/Myb domain
PROSITE profilePS5129422.435237287IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-22239285IPR009057Homeodomain-like
CDDcd001671.58E-13240283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MDLETMFKES YVSQPMDLQE SCLQPSMKDM LPFGNLPSHG LFQDFHHIDQ FHHVNVSSSI  60
QTPNFDVFDN FTITGSSPDF DFYEFKPFVE DGGNGHGHAH VMDNFLYGNY SLNLPPRNQL  120
DMMVANQSFL PFNPQEIKPS NFVVPDEVSR ISPMNYYKRV GENKNDKSYP TTRRTYKVRK  180
KSNVVKGQWT IEEDGLLIQL VEQYGLRKWS HIAKILPGRI GKQCRERWHN HLRPDIKKDT  240
WTDEEDKVLI EAHAEVGNKW AEIAKKLPGR TENSIKNHWN ATKRRQYSRR KCRSKYPRGT  300
LLQEYIKSLN LDKNPPRDYR RKSSSNYSSA IMSNNETTTS KVTTTAPTLP QTAFQFCAAT  360
DCLAPNYDFN VVPDFFFGEN FFEEGCSIDS LLDGVPCAPL MDNMKDFEGK LQCDDRTMCV  420
PFVNIDENHV ETEMPLEMMG VEVKKELDLV EMMSQISNEI LRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-461842862104C-Myb DNA-Binding Domain
1mse_C2e-461842862104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ6868710.0FJ686871.1 Glycine max clone gmw1-61M05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006582524.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L22e-93MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0B2QGI20.0A0A0B2QGI2_GLYSO; Transcription factor MYB98
STRINGGLYMA06G19280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-86myb domain protein 98
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]